LIM domain only 3 (LMO3) (NM_018640) Human Recombinant Protein
CAT#: TP305190
Recombinant protein of human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1, 20 µg
View other "LIM domain only 3" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205190 protein sequence
Red=Cloning site Green=Tags(s) MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRL FGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGY APQVR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061110 |
Locus ID | 55885 |
UniProt ID | Q8TAP4 |
Refseq Size | 3850 |
Cytogenetics | 12p12.3 |
Refseq ORF | 435 |
Synonyms | RBTN3; RBTNL2; Rhom-3; RHOM3 |
Summary | The protein encoded by this gene belongs to the rhombotin family of cysteine-rich LIM domain oncogenes. This gene is predominantly expressed in the brain. Related family members, LMO1 and LMO2 on chromosome 11, have been reported to be involved in chromosomal translocations in T-cell leukemia. Many alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2011] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402699 | LMO3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424337 | LMO3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402699 | Transient overexpression lysate of LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1 |
CNY 3080.00 |
|
LY424337 | Transient overexpression lysate of LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 2 |
CNY 3080.00 |
|
PH305190 | LMO3 MS Standard C13 and N15-labeled recombinant protein (NP_061110) |
CNY 19520.00 |
|
TP760247 | Recombinant protein of human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
|
TP761633 | Purified recombinant protein of Human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它LIM domain only 3产品