LIM domain only 3 (LMO3) (NM_018640) Human Mass Spec Standard
CAT#: PH305190
LMO3 MS Standard C13 and N15-labeled recombinant protein (NP_061110)
View other "LIM domain only 3" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | LMO3 MS Standard C13 and N15-labeled recombinant protein (NP_061110) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205190 |
Predicted MW | 16.6 kDa |
Protein Sequence |
>RC205190 protein sequence
Red=Cloning site Green=Tags(s) MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRL FGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGY APQVR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061110 |
RefSeq Size | 3850 |
RefSeq ORF | 435 |
Synonyms | RBTN3; RBTNL2; Rhom-3; RHOM3 |
Locus ID | 55885 |
Cytogenetics | 12p12.3 |
Summary | The protein encoded by this gene belongs to the rhombotin family of cysteine-rich LIM domain oncogenes. This gene is predominantly expressed in the brain. Related family members, LMO1 and LMO2 on chromosome 11, have been reported to be involved in chromosomal translocations in T-cell leukemia. Many alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2011] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402699 | LMO3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424337 | LMO3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402699 | Transient overexpression lysate of LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1 |
CNY 3080.00 |
|
LY424337 | Transient overexpression lysate of LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 2 |
CNY 3080.00 |
|
TP305190 | Recombinant protein of human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP760247 | Recombinant protein of human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
|
TP761633 | Purified recombinant protein of Human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它LIM domain only 3产品