LY6H (NM_002347) Human Recombinant Protein
CAT#: TP305136
Recombinant protein of human lymphocyte antigen 6 complex, locus H (LY6H), transcript variant 1, 20 µg
View other "LY6H" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205136 protein sequence
Red=Cloning site Green=Tags(s) MLPAAMKGLGLALLAVLLCSAPAHGLWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVN KMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002338 |
Locus ID | 4062 |
UniProt ID | O94772 |
Refseq Size | 950 |
Cytogenetics | 8q24.3 |
Refseq ORF | 420 |
Synonyms | NMLY6 |
Summary | Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response. May play a role in the intracellular trafficking of alpha-7-containing nAChRs and may inhibit their expression at the cell surface. Seems to inhibit alpha-7/CHRNA7 signaling in hippocampal neurons.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419383 | LY6H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419383 | Transient overexpression lysate of lymphocyte antigen 6 complex, locus H (LY6H), transcript variant 1 |
CNY 3080.00 |
|
PH305136 | LY6H MS Standard C13 and N15-labeled recombinant protein (NP_002338) |
CNY 19520.00 |