LY6H (NM_002347) Human Mass Spec Standard
CAT#: PH305136
LY6H MS Standard C13 and N15-labeled recombinant protein (NP_002338)
View other "LY6H" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | LY6H MS Standard C13 and N15-labeled recombinant protein (NP_002338) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205136 |
| Predicted MW | 14.7 kDa |
| Protein Sequence |
>RC205136 protein sequence
Red=Cloning site Green=Tags(s) MLPAAMKGLGLALLAVLLCSAPAHGLWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVN KMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002338 |
| RefSeq Size | 950 |
| RefSeq ORF | 420 |
| Synonyms | NMLY6 |
| Locus ID | 4062 |
| Cytogenetics | 8q24.3 |
| Summary | Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response. May play a role in the intracellular trafficking of alpha-7-containing nAChRs and may inhibit their expression at the cell surface. Seems to inhibit alpha-7/CHRNA7 signaling in hippocampal neurons.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419383 | LY6H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419383 | Transient overexpression lysate of lymphocyte antigen 6 complex, locus H (LY6H), transcript variant 1 |
CNY 3080.00 |
|
| TP305136 | Recombinant protein of human lymphocyte antigen 6 complex, locus H (LY6H), transcript variant 1, 20 µg |
CNY 2900.00 |
