TMIGD2 (NM_144615) Human Recombinant Protein
CAT#: TP304938
Recombinant protein of human transmembrane and immunoglobulin domain containing 2 (TMIGD2), 20 µg
View other "TMIGD2" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204938 protein sequence
Red=Cloning site Green=Tags(s) MGSPGMVLGLLVQIWALQEASSLSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPY ITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQ NRNRIASFPGFLFVLLGVGSMGVAAIVWGAWFWGRRSCQQRDSGNSPGNAFYSNVLYRPRGPPKKSEDCS GEGKDQRGQSIYSTSFPQPAPRQPHLASRPCPSPRPCPSPRPGHPVSMVRVSPRPSPTQQPRPKGFPKVG EE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_653216 |
Locus ID | 126259 |
UniProt ID | Q96BF3 |
Refseq Size | 1282 |
Cytogenetics | 19p13.3 |
Refseq ORF | 846 |
Synonyms | CD28H; IGPR-1; IGPR1 |
Summary | Plays a role in cell-cell interaction, cell migration, and angiogenesis. Through interaction with HHLA2, costimulates T-cells in the context of TCR-mediated activation. Enhances T-cell proliferation and cytokine production via an AKT-dependent signaling cascade.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408250 | TMIGD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432814 | TMIGD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408250 | Transient overexpression lysate of transmembrane and immunoglobulin domain containing 2 (TMIGD2), transcript variant 1 |
CNY 3080.00 |
|
LY432814 | Transient overexpression lysate of transmembrane and immunoglobulin domain containing 2 (TMIGD2), transcript variant 2 |
CNY 3080.00 |
|
PH304938 | TMIGD2 MS Standard C13 and N15-labeled recombinant protein (NP_653216) |
CNY 19520.00 |
|
TP329814 | Purified recombinant protein of Homo sapiens transmembrane and immunoglobulin domain containing 2 (TMIGD2), transcript variant 2, 20 µg |
CNY 2900.00 |