TMIGD2 (NM_144615) Human Mass Spec Standard
CAT#: PH304938
TMIGD2 MS Standard C13 and N15-labeled recombinant protein (NP_653216)
View other "TMIGD2" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | TMIGD2 MS Standard C13 and N15-labeled recombinant protein (NP_653216) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204938 |
Predicted MW | 30.7 kDa |
Protein Sequence |
>RC204938 protein sequence
Red=Cloning site Green=Tags(s) MGSPGMVLGLLVQIWALQEASSLSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPY ITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQ NRNRIASFPGFLFVLLGVGSMGVAAIVWGAWFWGRRSCQQRDSGNSPGNAFYSNVLYRPRGPPKKSEDCS GEGKDQRGQSIYSTSFPQPAPRQPHLASRPCPSPRPCPSPRPGHPVSMVRVSPRPSPTQQPRPKGFPKVG EE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_653216 |
RefSeq Size | 1282 |
RefSeq ORF | 846 |
Synonyms | CD28H; IGPR-1; IGPR1 |
Locus ID | 126259 |
Cytogenetics | 19p13.3 |
Summary | Plays a role in cell-cell interaction, cell migration, and angiogenesis. Through interaction with HHLA2, costimulates T-cells in the context of TCR-mediated activation. Enhances T-cell proliferation and cytokine production via an AKT-dependent signaling cascade.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408250 | TMIGD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432814 | TMIGD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408250 | Transient overexpression lysate of transmembrane and immunoglobulin domain containing 2 (TMIGD2), transcript variant 1 |
CNY 3080.00 |
|
LY432814 | Transient overexpression lysate of transmembrane and immunoglobulin domain containing 2 (TMIGD2), transcript variant 2 |
CNY 3080.00 |
|
TP304938 | Recombinant protein of human transmembrane and immunoglobulin domain containing 2 (TMIGD2), 20 µg |
CNY 2900.00 |
|
TP329814 | Purified recombinant protein of Homo sapiens transmembrane and immunoglobulin domain containing 2 (TMIGD2), transcript variant 2, 20 µg |
CNY 2900.00 |