SS18L2 (NM_016305) Human Recombinant Protein
CAT#: TP304667
Recombinant protein of human synovial sarcoma translocation gene on chromosome 18-like 2 (SS18L2), 20 µg
View other "SS18L2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204667 protein sequence
Red=Cloning site Green=Tags(s) MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLHRNLIYLATIADASPT STSKAME myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057389 |
Locus ID | 51188 |
UniProt ID | Q9UHA2 |
Refseq Size | 822 |
Cytogenetics | 3p22.1 |
Refseq ORF | 231 |
Synonyms | KIAA-iso |
Summary | Synovial sarcomas occur most frequently in the extremities around large joints. More than 90% of cases have a recurrent and specific chromosomal translocation, t(X;18)(p11.2;q11.2), in which the 5-prime end of the SS18 gene (MIM 600192) is fused in-frame to the 3-prime end of the SSX1 (MIM 312820), SSX2 (MIM 300192), or SSX4 (MIM 300326) gene. The SS18L2 gene is homologous to SS18.[supplied by OMIM, Jul 2002] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414076 | SS18L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414076 | Transient overexpression lysate of synovial sarcoma translocation gene on chromosome 18-like 2 (SS18L2) |
CNY 3080.00 |
|
PH304667 | SS18L2 MS Standard C13 and N15-labeled recombinant protein (NP_057389) |
CNY 19520.00 |