SS18L2 (NM_016305) Human Mass Spec Standard
CAT#: PH304667
SS18L2 MS Standard C13 and N15-labeled recombinant protein (NP_057389)
View other "SS18L2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | SS18L2 MS Standard C13 and N15-labeled recombinant protein (NP_057389) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204667 |
Predicted MW | 8.8 kDa |
Protein Sequence |
>RC204667 protein sequence
Red=Cloning site Green=Tags(s) MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLHRNLIYLATIADASPT STSKAME myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057389 |
RefSeq Size | 822 |
RefSeq ORF | 231 |
Synonyms | KIAA-iso |
Locus ID | 51188 |
Cytogenetics | 3p22.1 |
Summary | Synovial sarcomas occur most frequently in the extremities around large joints. More than 90% of cases have a recurrent and specific chromosomal translocation, t(X;18)(p11.2;q11.2), in which the 5-prime end of the SS18 gene (MIM 600192) is fused in-frame to the 3-prime end of the SSX1 (MIM 312820), SSX2 (MIM 300192), or SSX4 (MIM 300326) gene. The SS18L2 gene is homologous to SS18.[supplied by OMIM, Jul 2002] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414076 | SS18L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414076 | Transient overexpression lysate of synovial sarcoma translocation gene on chromosome 18-like 2 (SS18L2) |
CNY 3080.00 |
|
TP304667 | Recombinant protein of human synovial sarcoma translocation gene on chromosome 18-like 2 (SS18L2), 20 µg |
CNY 2900.00 |