IDI2 (NM_033261) Human Recombinant Protein
CAT#: TP304632
Recombinant protein of human isopentenyl-diphosphate delta isomerase 2 (IDI2), 20 µg
View other "IDI2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204632 protein sequence
Red=Cloning site Green=Tags(s) MSDINLDWVDRRQLQRLEEMLIVVDENDKVIGADTKRNCHLNENIEKGLLHRAFSVVLFNTKNRILIQQR SDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQRRLQAELGIPGEQISPEDIVFMTIYHHKAKS DRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLSQEELWELLEREARGEVKVTPWLRTIAERFLYRWWP HLDDVTPFVELHKIHRV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 26.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_150286 |
| Locus ID | 91734 |
| UniProt ID | Q9BXS1 |
| Refseq Size | 1359 |
| Cytogenetics | 10p15.3 |
| Refseq ORF | 681 |
| Synonyms | IPPI2 |
| Summary | The protein encoded by this gene catalyzes the conversion of isopentenyl diphosphate to dimethylallyl diphosphate, which is a precursor for the synthesis of cholesterol and other isoprenoids. This gene, which is a product of an ancestral gene duplication event, encodes a protein that may be involved in the aggregation of alpha-synuclein in the cerebral cortex of patients with Lewy body disease. In addition, segmental copy number gains in this locus have been associated with sporadic amyotrophic lateral sclerosis. [provided by RefSeq, Jul 2016] |
| Protein Pathways | Metabolic pathways, Terpenoid backbone biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409635 | IDI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409635 | Transient overexpression lysate of isopentenyl-diphosphate delta isomerase 2 (IDI2) |
CNY 3080.00 |
|
| PH304632 | IDI2 MS Standard C13 and N15-labeled recombinant protein (NP_150286) |
CNY 19520.00 |
|
| TP720549 | Recombinant protein of human isopentenyl-diphosphate delta isomerase 2 (IDI2) |
CNY 1800.00 |
