ACN9 (SDHAF3) (NM_020186) Human Recombinant Protein
CAT#: TP304626
Recombinant protein of human ACN9 homolog (S. cerevisiae) (ACN9), 20 µg
View other "ACN9" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204626 protein sequence
Red=Cloning site Green=Tags(s) MPGRHVSRVRALYKRVLQLHRVLPPDLKSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANE NRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064571 |
Locus ID | 57001 |
UniProt ID | Q9NRP4 |
Refseq Size | 2068 |
Cytogenetics | 7q21.3 |
Refseq ORF | 375 |
Synonyms | ACN9; DC11; LYRM10; Sdh7 |
Summary | Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Promotes maturation of the iron-sulfur protein subunit SDHB of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants. May act together with SDHAF1.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412608 | SDHAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412608 | Transient overexpression lysate of ACN9 homolog (S. cerevisiae) (ACN9) |
CNY 3080.00 |
|
PH304626 | ACN9 MS Standard C13 and N15-labeled recombinant protein (NP_064571) |
CNY 19520.00 |