ACN9 (SDHAF3) (NM_020186) Human Mass Spec Standard
CAT#: PH304626
ACN9 MS Standard C13 and N15-labeled recombinant protein (NP_064571)
View other "ACN9" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ACN9 MS Standard C13 and N15-labeled recombinant protein (NP_064571) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204626 |
Predicted MW | 14.7 kDa |
Protein Sequence |
>RC204626 protein sequence
Red=Cloning site Green=Tags(s) MPGRHVSRVRALYKRVLQLHRVLPPDLKSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANE NRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_064571 |
RefSeq Size | 2068 |
RefSeq ORF | 375 |
Synonyms | ACN9; DC11; LYRM10; Sdh7 |
Locus ID | 57001 |
Cytogenetics | 7q21.3 |
Summary | Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Promotes maturation of the iron-sulfur protein subunit SDHB of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants. May act together with SDHAF1.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412608 | SDHAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412608 | Transient overexpression lysate of ACN9 homolog (S. cerevisiae) (ACN9) |
CNY 3080.00 |
|
TP304626 | Recombinant protein of human ACN9 homolog (S. cerevisiae) (ACN9), 20 µg |
CNY 2900.00 |