TFIIB (GTF2B) (NM_001514) Human Recombinant Protein
CAT#: TP304607
Recombinant protein of human general transcription factor IIB (GTF2B), 20 µg
View other "TFIIB" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204607 protein sequence
Red=Cloning site Green=Tags(s) MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDS QNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNN LFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLIT TGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGV ADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 34.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001505 |
| Locus ID | 2959 |
| UniProt ID | Q00403 |
| Refseq Size | 1651 |
| Cytogenetics | 1p22.2 |
| Refseq ORF | 948 |
| Synonyms | TF2B; TFIIB |
| Summary | This gene encodes the general transcription factor IIB, one of the ubiquitous factors required for transcription initiation by RNA polymerase II. The protein localizes to the nucleus where it forms a complex (the DAB complex) with transcription factors IID and IIA. Transcription factor IIB serves as a bridge between IID, the factor which initially recognizes the promoter sequence, and RNA polymerase II. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Basal transcription factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400582 | GTF2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400582 | Transient overexpression lysate of general transcription factor IIB (GTF2B) |
CNY 3080.00 |
|
| PH304607 | GTF2B MS Standard C13 and N15-labeled recombinant protein (NP_001505) |
CNY 19520.00 |
|
| TP720263 | Recombinant protein of human general transcription factor IIB (GTF2B) |
CNY 1800.00 |
