TFIIB (GTF2B) (NM_001514) Human Mass Spec Standard
CAT#: PH304607
GTF2B MS Standard C13 and N15-labeled recombinant protein (NP_001505)
View other "TFIIB" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | GTF2B MS Standard C13 and N15-labeled recombinant protein (NP_001505) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204607 |
Predicted MW | 34.8 kDa |
Protein Sequence |
>RC204607 protein sequence
Red=Cloning site Green=Tags(s) MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDS QNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNN LFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLIT TGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGV ADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001505 |
RefSeq Size | 1651 |
RefSeq ORF | 948 |
Synonyms | TF2B; TFIIB |
Locus ID | 2959 |
Cytogenetics | 1p22.2 |
Summary | This gene encodes the general transcription factor IIB, one of the ubiquitous factors required for transcription initiation by RNA polymerase II. The protein localizes to the nucleus where it forms a complex (the DAB complex) with transcription factors IID and IIA. Transcription factor IIB serves as a bridge between IID, the factor which initially recognizes the promoter sequence, and RNA polymerase II. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Basal transcription factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400582 | GTF2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400582 | Transient overexpression lysate of general transcription factor IIB (GTF2B) |
CNY 3080.00 |
|
TP304607 | Recombinant protein of human general transcription factor IIB (GTF2B), 20 µg |
CNY 2900.00 |
|
TP720263 | Recombinant protein of human general transcription factor IIB (GTF2B) |
CNY 1800.00 |