PFDN2 (NM_012394) Human Recombinant Protein
CAT#: TP304553
Recombinant protein of human prefoldin subunit 2 (PFDN2), 20 µg
View other "PFDN2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204553 protein sequence
Red=Cloning site Green=Tags(s) MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKC YRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSE GAGAKASSAGVLVS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036526 |
Locus ID | 5202 |
UniProt ID | Q9UHV9 |
Refseq Size | 668 |
Cytogenetics | 1q23.3 |
Refseq ORF | 462 |
Synonyms | PFD2 |
Summary | This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415791 | PFDN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415791 | Transient overexpression lysate of prefoldin subunit 2 (PFDN2) |
CNY 3080.00 |
|
PH304553 | PFDN2 MS Standard C13 and N15-labeled recombinant protein (NP_036526) |
CNY 19520.00 |
|
TP720227 | Recombinant protein of human prefoldin subunit 2 (PFDN2) |
CNY 1800.00 |