PFDN2 (NM_012394) Human Mass Spec Standard
CAT#: PH304553
PFDN2 MS Standard C13 and N15-labeled recombinant protein (NP_036526)
View other "PFDN2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PFDN2 MS Standard C13 and N15-labeled recombinant protein (NP_036526) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204553 |
Predicted MW | 16.6 kDa |
Protein Sequence |
>RC204553 protein sequence
Red=Cloning site Green=Tags(s) MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKC YRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSE GAGAKASSAGVLVS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036526 |
RefSeq Size | 668 |
RefSeq ORF | 462 |
Synonyms | PFD2 |
Locus ID | 5202 |
Cytogenetics | 1q23.3 |
Summary | This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415791 | PFDN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415791 | Transient overexpression lysate of prefoldin subunit 2 (PFDN2) |
CNY 3080.00 |
|
TP304553 | Recombinant protein of human prefoldin subunit 2 (PFDN2), 20 µg |
CNY 2900.00 |
|
TP720227 | Recombinant protein of human prefoldin subunit 2 (PFDN2) |
CNY 1800.00 |