CTRP6 (C1QTNF6) (NM_031910) Human Recombinant Protein
CAT#: TP304524
Recombinant protein of human C1q and tumor necrosis factor related protein 6 (C1QTNF6), transcript variant 1, 20 µg
View other "CTRP6" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204524 protein sequence
Red=Cloning site Green=Tags(s) MQWLRVRESPGEATGHRVTMVTAALGPVWAALLLFLLMCEIPMVELTFDRAVASGCQRCCDSEDPLDPAH VSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQ KRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLRGIYFFSLNVHSWNYKETYVHIM HNQKEAVILYAQPSERSIMQSQSVMLDLAYGDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_114116 |
Locus ID | 114904 |
UniProt ID | Q9BXI9 |
Refseq Size | 2954 |
Cytogenetics | 22q12.3 |
Refseq ORF | 834 |
Synonyms | CTFP6; CTRP6; ZACRP6 |
Protein Families | Secreted Protein, Transmembrane |
Shipping | Dry Ice |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
C1q/TNF-Related Protein 6 Is a Pattern Recognition Molecule That Recruits Collectin-11 from the Complement System to Ligands
,Kirketerp-Møller, N;Bayarri-Olmos, R;Krogfelt, KA;Garred, P;,
J. Immunol.
,PubMed ID 32041782
[C1QTNF6]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403130 | C1QTNF6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405547 | C1QTNF6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403130 | Transient overexpression lysate of C1q and tumor necrosis factor related protein 6 (C1QTNF6), transcript variant 1 |
CNY 3080.00 |
|
LY405547 | Transient overexpression lysate of C1q and tumor necrosis factor related protein 6 (C1QTNF6), transcript variant 2 |
CNY 3080.00 |
|
PH304524 | C1QTNF6 MS Standard C13 and N15-labeled recombinant protein (NP_114116) |
CNY 19520.00 |