CTRP6 (C1QTNF6) (NM_031910) Human Recombinant Protein
CAT#: TP304524
Recombinant protein of human C1q and tumor necrosis factor related protein 6 (C1QTNF6), transcript variant 1, 20 µg
View other "CTRP6" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204524 protein sequence
Red=Cloning site Green=Tags(s) MQWLRVRESPGEATGHRVTMVTAALGPVWAALLLFLLMCEIPMVELTFDRAVASGCQRCCDSEDPLDPAH VSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQ KRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLRGIYFFSLNVHSWNYKETYVHIM HNQKEAVILYAQPSERSIMQSQSVMLDLAYGDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 30.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_114116 |
| Locus ID | 114904 |
| UniProt ID | Q9BXI9 |
| Refseq Size | 2954 |
| Cytogenetics | 22q12.3 |
| Refseq ORF | 834 |
| Synonyms | CTFP6; CTRP6; ZACRP6 |
| Protein Families | Secreted Protein, Transmembrane |
| Shipping | Dry Ice |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
C1q/TNF-Related Protein 6 Is a Pattern Recognition Molecule That Recruits Collectin-11 from the Complement System to Ligands
,Kirketerp-Møller, N;Bayarri-Olmos, R;Krogfelt, KA;Garred, P;,
J. Immunol.
,PubMed ID 32041782
[C1QTNF6]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403130 | C1QTNF6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405547 | C1QTNF6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403130 | Transient overexpression lysate of C1q and tumor necrosis factor related protein 6 (C1QTNF6), transcript variant 1 |
CNY 3080.00 |
|
| LY405547 | Transient overexpression lysate of C1q and tumor necrosis factor related protein 6 (C1QTNF6), transcript variant 2 |
CNY 3080.00 |
|
| PH304524 | C1QTNF6 MS Standard C13 and N15-labeled recombinant protein (NP_114116) |
CNY 19520.00 |
