CTRP6 (C1QTNF6) (NM_031910) Human Mass Spec Standard
CAT#: PH304524
C1QTNF6 MS Standard C13 and N15-labeled recombinant protein (NP_114116)
View other "CTRP6" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | C1QTNF6 MS Standard C13 and N15-labeled recombinant protein (NP_114116) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204524 |
| Predicted MW | 30.9 kDa |
| Protein Sequence |
>RC204524 protein sequence
Red=Cloning site Green=Tags(s) MQWLRVRESPGEATGHRVTMVTAALGPVWAALLLFLLMCEIPMVELTFDRAVASGCQRCCDSEDPLDPAH VSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQ KRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLRGIYFFSLNVHSWNYKETYVHIM HNQKEAVILYAQPSERSIMQSQSVMLDLAYGDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_114116 |
| RefSeq Size | 2954 |
| RefSeq ORF | 834 |
| Synonyms | CTFP6; CTRP6; ZACRP6 |
| Locus ID | 114904 |
| Cytogenetics | 22q12.3 |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403130 | C1QTNF6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405547 | C1QTNF6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403130 | Transient overexpression lysate of C1q and tumor necrosis factor related protein 6 (C1QTNF6), transcript variant 1 |
CNY 3080.00 |
|
| LY405547 | Transient overexpression lysate of C1q and tumor necrosis factor related protein 6 (C1QTNF6), transcript variant 2 |
CNY 3080.00 |
|
| TP304524 | Recombinant protein of human C1q and tumor necrosis factor related protein 6 (C1QTNF6), transcript variant 1, 20 µg |
CNY 2900.00 |
