PARP3 (NM_005485) Human Recombinant Protein
CAT#: TP304308
Recombinant protein of human poly (ADP-ribose) polymerase family, member 3 (PARP3), transcript variant 2, 20 µg
View other "PARP3" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204308 protein sequence
Red=Cloning site Green=Tags(s) MAPKPKPWVQTEGPEKKKGRQAGREEDPFRSTAEALKAIPAEKRIIRVDPTCPLSSNPGTQVYEDYNCTL NQTNIENNNNKFYIIQLLQDSNRFFTCWNRWGRVGEVGQSKINHFTRLEDAKKDFEKKFREKTKNNWAER DHFVSHPGKYTLIEVQAEDEAQEAVVKVDRGPVRTVTKRVQPCSLDPATQKLITNIFSKEMFKNTMALMD LDVKKMPLGKLSKQQIARGFEALEALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQ AKKDMLLVLADIELAQALQAVSEQEKTVEEVPHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNH RCPTLQHIWKVNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENS KSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQ QVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRYLLEVHL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 59.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005476 |
| Locus ID | 10039 |
| UniProt ID | Q9Y6F1 |
| Refseq Size | 2360 |
| Cytogenetics | 3p21.2 |
| Refseq ORF | 1599 |
| Synonyms | ADPRT3; ADPRTL2; ADPRTL3; ARTD3; IRT1; PADPRT-3 |
| Summary | The protein encoded by this gene belongs to the PARP family. These enzymes modify nuclear proteins by poly-ADP-ribosylation, which is required for DNA repair, regulation of apoptosis, and maintenance of genomic stability. This gene encodes the poly(ADP-ribosyl)transferase 3, which is preferentially localized to the daughter centriole throughout the cell cycle. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Base excision repair |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401680 | PARP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424036 | PARP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401680 | Transient overexpression lysate of poly (ADP-ribose) polymerase family, member 3 (PARP3), transcript variant 2 |
CNY 3080.00 |
|
| LY424036 | Transient overexpression lysate of poly (ADP-ribose) polymerase family, member 3 (PARP3), transcript variant 3 |
CNY 3080.00 |
|
| PH304308 | PARP3 MS Standard C13 and N15-labeled recombinant protein (NP_005476) |
CNY 19520.00 |
