Tcl1 (TCL1A) (NM_021966) Human Recombinant Protein
CAT#: TP304243
Recombinant protein of human T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 1, 20 µg
View other "Tcl1" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204243 protein sequence
Red=Cloning site Green=Tags(s) MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPS LLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_068801 |
Locus ID | 8115 |
UniProt ID | P56279 |
Refseq Size | 1410 |
Cytogenetics | 14q32.13 |
Refseq ORF | 342 |
Synonyms | TCL1 |
Summary | Overexpression of the TCL1 gene in humans has been implicated in the development of mature T cell leukemia, in which chromosomal rearrangements bring the TCL1 gene in close proximity to the T-cell antigen receptor (TCR)-alpha (MIM 186880) or TCR-beta (MIM 186930) regulatory elements (summarized by Virgilio et al., 1998 [PubMed 9520462]). In normal T cells TCL1 is expressed in CD4-/CD8- cells, but not in cells at later stages of differentiation. TCL1 functions as a coactivator of the cell survival kinase AKT (MIM 164730) (Laine et al., 2000 [PubMed 10983986]).[supplied by OMIM, Jul 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411851 | TCL1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420669 | TCL1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426041 | TCL1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411851 | Transient overexpression lysate of T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 1 |
CNY 3080.00 |
|
LY420669 | Transient overexpression lysate of T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 2 |
CNY 3080.00 |
|
PH304243 | TCL1A MS Standard C13 and N15-labeled recombinant protein (NP_068801) |
CNY 19520.00 |
|
PH313051 | TCL1A MS Standard C13 and N15-labeled recombinant protein (NP_001092195) |
CNY 19520.00 |
|
TP313051 | Recombinant protein of human T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 2, 20 µg |
CNY 2900.00 |