Tcl1 (TCL1A) (NM_021966) Human Mass Spec Standard
CAT#: PH304243
TCL1A MS Standard C13 and N15-labeled recombinant protein (NP_068801)
View other "Tcl1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TCL1A MS Standard C13 and N15-labeled recombinant protein (NP_068801) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204243 |
| Predicted MW | 13.5 kDa |
| Protein Sequence |
>RC204243 protein sequence
Red=Cloning site Green=Tags(s) MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPS LLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_068801 |
| RefSeq Size | 1410 |
| RefSeq ORF | 342 |
| Synonyms | TCL1 |
| Locus ID | 8115 |
| Cytogenetics | 14q32.13 |
| Summary | Overexpression of the TCL1 gene in humans has been implicated in the development of mature T cell leukemia, in which chromosomal rearrangements bring the TCL1 gene in close proximity to the T-cell antigen receptor (TCR)-alpha (MIM 186880) or TCR-beta (MIM 186930) regulatory elements (summarized by Virgilio et al., 1998 [PubMed 9520462]). In normal T cells TCL1 is expressed in CD4-/CD8- cells, but not in cells at later stages of differentiation. TCL1 functions as a coactivator of the cell survival kinase AKT (MIM 164730) (Laine et al., 2000 [PubMed 10983986]).[supplied by OMIM, Jul 2010] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411851 | TCL1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420669 | TCL1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426041 | TCL1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411851 | Transient overexpression lysate of T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 1 |
CNY 3080.00 |
|
| LY420669 | Transient overexpression lysate of T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 2 |
CNY 3080.00 |
|
| PH313051 | TCL1A MS Standard C13 and N15-labeled recombinant protein (NP_001092195) |
CNY 19520.00 |
|
| TP304243 | Recombinant protein of human T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP313051 | Recombinant protein of human T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 2, 20 µg |
CNY 2900.00 |
