Glutamine Synthetase (GLUL) (NM_002065) Human Recombinant Protein
CAT#: TP304161
Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 1, 20 µg
View other "Glutamine Synthetase" proteins (14)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204161 protein sequence
Red=Cloning site Green=Tags(s) MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQS EGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLM GTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCE GISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKR HQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS VTEALIRTCLLNETGDEPFQYKN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002056 |
Locus ID | 2752 |
UniProt ID | P15104, A8YXX4 |
Refseq Size | 4737 |
Cytogenetics | 1q25.3 |
Refseq ORF | 1119 |
Synonyms | GLNS; GS; PIG43; PIG59 |
Summary | The protein encoded by this gene belongs to the glutamine synthetase family. It catalyzes the synthesis of glutamine from glutamate and ammonia in an ATP-dependent reaction. This protein plays a role in ammonia and glutamate detoxification, acid-base homeostasis, cell signaling, and cell proliferation. Glutamine is an abundant amino acid, and is important to the biosynthesis of several amino acids, pyrimidines, and purines. Mutations in this gene are associated with congenital glutamine deficiency, and overexpression of this gene was observed in some primary liver cancer samples. There are six pseudogenes of this gene found on chromosomes 2, 5, 9, 11, and 12. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014] |
Protein Pathways | Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Metabolic pathways, Nitrogen metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400756 | GLUL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422348 | GLUL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422357 | GLUL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400756 | Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 1 |
CNY 3,080.00 |
|
LY422348 | Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 2 |
CNY 3,080.00 |
|
LY422357 | Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 3 |
CNY 3,080.00 |
|
PH304039 | GLUL MS Standard C13 and N15-labeled recombinant protein (NP_001028228) |
CNY 19,520.00 |
|
PH304161 | GLUL MS Standard C13 and N15-labeled recombinant protein (NP_002056) |
CNY 19,520.00 |
|
PH304238 | GLUL MS Standard C13 and N15-labeled recombinant protein (NP_001028216) |
CNY 19,520.00 |
|
TP304039 | Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP304238 | Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP720579 | Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 1 |
CNY 5,460.00 |
|
TP750165 | Purified recombinant protein of Human glutamate-ammonia ligase (GLUL), transcript variant 1, full length, with C-terminal His tag, expressed in E.coli, 50ug |
CNY 1,948.00 |
|
TP762417 | Purified recombinant protein of Human glutamate-ammonia ligase (GLUL), transcript variant 3, full length, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
其它Glutamine Synthetase产品