Glutamine Synthetase (GLUL) (NM_001033044) Human Mass Spec Standard
CAT#: PH304238
GLUL MS Standard C13 and N15-labeled recombinant protein (NP_001028216)
View other "Glutamine Synthetase" proteins (14)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | GLUL MS Standard C13 and N15-labeled recombinant protein (NP_001028216) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204238 |
| Predicted MW | 42.1 kDa |
| Protein Sequence |
>RC204238 protein sequence
Red=Cloning site Green=Tags(s) MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQS EGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLM GTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCE GISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKR HQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS VTEALIRTCLLNETGDEPFQYKN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001028216 |
| RefSeq Size | 4381 |
| RefSeq ORF | 1119 |
| Synonyms | GLNS; GS; PIG43; PIG59 |
| Locus ID | 2752 |
| Cytogenetics | 1q25.3 |
| Summary | The protein encoded by this gene belongs to the glutamine synthetase family. It catalyzes the synthesis of glutamine from glutamate and ammonia in an ATP-dependent reaction. This protein plays a role in ammonia and glutamate detoxification, acid-base homeostasis, cell signaling, and cell proliferation. Glutamine is an abundant amino acid, and is important to the biosynthesis of several amino acids, pyrimidines, and purines. Mutations in this gene are associated with congenital glutamine deficiency, and overexpression of this gene was observed in some primary liver cancer samples. There are six pseudogenes of this gene found on chromosomes 2, 5, 9, 11, and 12. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014] |
| Protein Pathways | Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Metabolic pathways, Nitrogen metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400756 | GLUL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422348 | GLUL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422357 | GLUL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400756 | Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 1 |
CNY 3080.00 |
|
| LY422348 | Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 2 |
CNY 3080.00 |
|
| LY422357 | Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 3 |
CNY 3080.00 |
|
| PH304039 | GLUL MS Standard C13 and N15-labeled recombinant protein (NP_001028228) |
CNY 19520.00 |
|
| PH304161 | GLUL MS Standard C13 and N15-labeled recombinant protein (NP_002056) |
CNY 19520.00 |
|
| TP304039 | Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP304161 | Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP304238 | Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP720579 | Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 1 |
CNY 1800.00 |
|
| TP750165 | Purified recombinant protein of Human glutamate-ammonia ligase (GLUL), transcript variant 1, full length, with C-terminal His tag, expressed in E.coli, 50ug |
CNY 1948.00 |
|
| TP762417 | Purified recombinant protein of Human glutamate-ammonia ligase (GLUL), transcript variant 3, full length, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |
其它Glutamine Synthetase产品
