COTL1 (NM_021149) Human Recombinant Protein
CAT#: TP304055
Recombinant protein of human coactosin-like 1 (Dictyostelium) (COTL1), 20 µg
View other "COTL1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204055 protein sequence
Red=Cloning site Green=Tags(s) MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAM SKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQ TE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 15.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_066972 |
| Locus ID | 23406 |
| UniProt ID | Q14019 |
| Refseq Size | 1893 |
| Cytogenetics | 16q24.1 |
| Refseq ORF | 426 |
| Synonyms | CLP |
| Summary | This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has been reported to map to chromosome 17 in the Smith-Magenis syndrome region, the best alignments for this gene are to chromosome 16. The Smith-Magenis syndrome region is the site of two related pseudogenes. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402845 | COTL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402845 | Transient overexpression lysate of coactosin-like 1 (Dictyostelium) (COTL1) |
CNY 3080.00 |
|
| PH304055 | COTL1 MS Standard C13 and N15-labeled recombinant protein (NP_066972) |
CNY 19520.00 |
