COTL1 (NM_021149) Human Mass Spec Standard
CAT#: PH304055
COTL1 MS Standard C13 and N15-labeled recombinant protein (NP_066972)
View other "COTL1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | COTL1 MS Standard C13 and N15-labeled recombinant protein (NP_066972) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204055 |
Predicted MW | 15.9 kDa |
Protein Sequence |
>RC204055 protein sequence
Red=Cloning site Green=Tags(s) MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAM SKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQ TE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_066972 |
RefSeq Size | 1893 |
RefSeq ORF | 426 |
Synonyms | CLP |
Locus ID | 23406 |
Cytogenetics | 16q24.1 |
Summary | This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has been reported to map to chromosome 17 in the Smith-Magenis syndrome region, the best alignments for this gene are to chromosome 16. The Smith-Magenis syndrome region is the site of two related pseudogenes. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402845 | COTL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402845 | Transient overexpression lysate of coactosin-like 1 (Dictyostelium) (COTL1) |
CNY 3080.00 |
|
TP304055 | Recombinant protein of human coactosin-like 1 (Dictyostelium) (COTL1), 20 µg |
CNY 2900.00 |