SF20 (MYDGF) (NM_019107) Human Recombinant Protein
CAT#: TP304011
Recombinant protein of human chromosome 19 open reading frame 10 (C19orf10), 20 µg
View other "SF20" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204011 protein sequence
Red=Cloning site Green=Tags(s) MAAPSGGWNGVGASLWAALLLGAVALRPAEAVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQ GGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEE FEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061980 |
Locus ID | 56005 |
UniProt ID | Q969H8 |
Refseq Size | 1067 |
Cytogenetics | 19p13.3 |
Refseq ORF | 519 |
Synonyms | C19orf10; EUROIMAGE1875335; IL25; IL27; IL27w; R33729_1; SF20 |
Summary | The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was considered an interleukin. However, this activity has not been reproducible and the function of this protein is currently unknown. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402744 | MYDGF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402744 | Transient overexpression lysate of chromosome 19 open reading frame 10 (C19orf10) |
CNY 3080.00 |
|
PH304011 | C19orf10 MS Standard C13 and N15-labeled recombinant protein (NP_061980) |
CNY 19520.00 |
|
TP720999 | Purified recombinant protein of Human chromosome 19 open reading frame 10 (C19orf10) |
CNY 1800.00 |