SF20 (MYDGF) (NM_019107) Human Mass Spec Standard
CAT#: PH304011
C19orf10 MS Standard C13 and N15-labeled recombinant protein (NP_061980)
View other "SF20" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | C19orf10 MS Standard C13 and N15-labeled recombinant protein (NP_061980) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204011 |
Predicted MW | 18.8 kDa |
Protein Sequence |
>RC204011 protein sequence
Red=Cloning site Green=Tags(s) MAAPSGGWNGVGASLWAALLLGAVALRPAEAVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQ GGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEE FEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061980 |
RefSeq Size | 1067 |
RefSeq ORF | 519 |
Synonyms | C19orf10; EUROIMAGE1875335; IL25; IL27; IL27w; R33729_1; SF20 |
Locus ID | 56005 |
Cytogenetics | 19p13.3 |
Summary | The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was considered an interleukin. However, this activity has not been reproducible and the function of this protein is currently unknown. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402744 | MYDGF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402744 | Transient overexpression lysate of chromosome 19 open reading frame 10 (C19orf10) |
CNY 3080.00 |
|
TP304011 | Recombinant protein of human chromosome 19 open reading frame 10 (C19orf10), 20 µg |
CNY 2900.00 |
|
TP720999 | Purified recombinant protein of Human chromosome 19 open reading frame 10 (C19orf10) |
CNY 1800.00 |