NCE2 (UBE2F) (NM_080678) Human Recombinant Protein
CAT#: TP303942
Recombinant protein of human ubiquitin-conjugating enzyme E2F (putative) (UBE2F), 20 µg
View other "NCE2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203942 representing NM_080678
Red=Cloning site Green=Tags(s) MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVT PDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVV WGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_542409 |
| Locus ID | 140739 |
| UniProt ID | Q969M7 |
| Refseq Size | 1366 |
| Cytogenetics | 2q37.3 |
| Refseq ORF | 555 |
| Synonyms | NCE2 |
| Summary | Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.[UniProtKB/Swiss-Prot Function] |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409102 | UBE2F HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409102 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2F (putative) (UBE2F) |
CNY 3080.00 |
|
| PH303942 | UBE2F MS Standard C13 and N15-labeled recombinant protein (NP_542409) |
CNY 19520.00 |
