NCE2 (UBE2F) (NM_080678) Human Mass Spec Standard
CAT#: PH303942
UBE2F MS Standard C13 and N15-labeled recombinant protein (NP_542409)
View other "NCE2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | UBE2F MS Standard C13 and N15-labeled recombinant protein (NP_542409) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203942 |
| Predicted MW | 20.9 kDa |
| Protein Sequence |
>RC203942 representing NM_080678
Red=Cloning site Green=Tags(s) MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVT PDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVV WGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_542409 |
| RefSeq Size | 1366 |
| RefSeq ORF | 555 |
| Synonyms | NCE2 |
| Locus ID | 140739 |
| Cytogenetics | 2q37.3 |
| Summary | Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.[UniProtKB/Swiss-Prot Function] |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409102 | UBE2F HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409102 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2F (putative) (UBE2F) |
CNY 3080.00 |
|
| TP303942 | Recombinant protein of human ubiquitin-conjugating enzyme E2F (putative) (UBE2F), 20 µg |
CNY 2900.00 |
