Adiponectin Receptor 1 (ADIPOR1) (NM_015999) Human Recombinant Protein
CAT#: TP303907
Recombinant protein of human adiponectin receptor 1 (ADIPOR1), transcript variant 1, 20 µg
View other "Adiponectin Receptor 1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203907 protein sequence
Red=Cloning site Green=Tags(s) MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLP LQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWT HLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYS GIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVV PTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFV HFYGVSNLQEFRYGLEGGCTDDTLL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 42.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057083 |
| Locus ID | 51094 |
| UniProt ID | Q96A54 |
| Refseq Size | 2184 |
| Cytogenetics | 1q32.1 |
| Refseq ORF | 1125 |
| Synonyms | ACDCR1; CGI-45; CGI45; PAQR1; TESBP1A |
| Summary | This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Adipocytokine signaling pathway |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Underactivation of the adiponectin-adiponectin receptor 1 axis in clear cell renal cell carcinoma: implications for progression.
,null,
Clinical experimental metastasis
,PubMed ID 24096711
[ADIPOR1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402486 | ADIPOR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426849 | ADIPOR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402486 | Transient overexpression lysate of adiponectin receptor 1 (ADIPOR1), transcript variant 1 |
CNY 3080.00 |
|
| LY426849 | Transient overexpression lysate of adiponectin receptor 1 (ADIPOR1), transcript variant 2 |
CNY 3080.00 |
|
| PH303907 | ADIPOR1 MS Standard C13 and N15-labeled recombinant protein (NP_057083) |
CNY 19520.00 |
其它Adiponectin Receptor 1产品


