Adiponectin Receptor 1 (ADIPOR1) (NM_015999) Human Mass Spec Standard
CAT#: PH303907
ADIPOR1 MS Standard C13 and N15-labeled recombinant protein (NP_057083)
View other "Adiponectin Receptor 1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ADIPOR1 MS Standard C13 and N15-labeled recombinant protein (NP_057083) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203907 |
| Predicted MW | 42.6 kDa |
| Protein Sequence |
>RC203907 protein sequence
Red=Cloning site Green=Tags(s) MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLP LQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWT HLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYS GIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVV PTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFV HFYGVSNLQEFRYGLEGGCTDDTLL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057083 |
| RefSeq Size | 2184 |
| RefSeq ORF | 1125 |
| Synonyms | ACDCR1; CGI-45; CGI45; PAQR1; TESBP1A |
| Locus ID | 51094 |
| Cytogenetics | 1q32.1 |
| Summary | This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Adipocytokine signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402486 | ADIPOR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426849 | ADIPOR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402486 | Transient overexpression lysate of adiponectin receptor 1 (ADIPOR1), transcript variant 1 |
CNY 3080.00 |
|
| LY426849 | Transient overexpression lysate of adiponectin receptor 1 (ADIPOR1), transcript variant 2 |
CNY 3080.00 |
|
| TP303907 | Recombinant protein of human adiponectin receptor 1 (ADIPOR1), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Adiponectin Receptor 1产品


