HEBP2 (NM_014320) Human Recombinant Protein
CAT#: TP303899
Recombinant protein of human heme binding protein 2 (HEBP2), 20 µg
View other "HEBP2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203899 protein sequence
Red=Cloning site Green=Tags(s) MAEPLQPDPGAAEDAAAQAVETPGWKAPEDAGPQPGSYEIRHYGPAKWVSTSVESMDWDSAIQTGFTKLN SYIQGKNEKEMKIKMTAPVTSYVEPGSGPFSESTITISLYIPSEQQFDPPRPLESDVFIEDRAEMTVFVR SFDGFSSAQKNQEQLLTLASILREDGKVFDEKVYYTAGYNSPVKLLNRNNEVWLIQKNEPTKENE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055135 |
Locus ID | 23593 |
UniProt ID | Q9Y5Z4 |
Refseq Size | 1282 |
Cytogenetics | 6q24.1 |
Refseq ORF | 615 |
Synonyms | C6orf34; C6ORF34B; PP23; SOUL |
Summary | The protein encoded by this gene is found predominately in the cytoplasm, where it plays a role in the collapse of mitochondrial membrane potential (MMP) prior to necrotic cell death. The encoded protein enhances outer and inner mitochondrial membrane permeabilization, especially under conditions of oxidative stress. [provided by RefSeq, May 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402312 | HEBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402312 | Transient overexpression lysate of heme binding protein 2 (HEBP2) |
CNY 3080.00 |
|
PH303899 | HEBP2 MS Standard C13 and N15-labeled recombinant protein (NP_055135) |
CNY 19520.00 |