HEBP2 (NM_014320) Human Mass Spec Standard
CAT#: PH303899
HEBP2 MS Standard C13 and N15-labeled recombinant protein (NP_055135)
View other "HEBP2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | HEBP2 MS Standard C13 and N15-labeled recombinant protein (NP_055135) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203899 |
Predicted MW | 22.9 kDa |
Protein Sequence |
>RC203899 protein sequence
Red=Cloning site Green=Tags(s) MAEPLQPDPGAAEDAAAQAVETPGWKAPEDAGPQPGSYEIRHYGPAKWVSTSVESMDWDSAIQTGFTKLN SYIQGKNEKEMKIKMTAPVTSYVEPGSGPFSESTITISLYIPSEQQFDPPRPLESDVFIEDRAEMTVFVR SFDGFSSAQKNQEQLLTLASILREDGKVFDEKVYYTAGYNSPVKLLNRNNEVWLIQKNEPTKENE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055135 |
RefSeq Size | 1282 |
RefSeq ORF | 615 |
Synonyms | C6orf34; C6ORF34B; PP23; SOUL |
Locus ID | 23593 |
Cytogenetics | 6q24.1 |
Summary | The protein encoded by this gene is found predominately in the cytoplasm, where it plays a role in the collapse of mitochondrial membrane potential (MMP) prior to necrotic cell death. The encoded protein enhances outer and inner mitochondrial membrane permeabilization, especially under conditions of oxidative stress. [provided by RefSeq, May 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402312 | HEBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402312 | Transient overexpression lysate of heme binding protein 2 (HEBP2) |
CNY 3080.00 |
|
TP303899 | Recombinant protein of human heme binding protein 2 (HEBP2), 20 µg |
CNY 2900.00 |