VSIG4 (NM_007268) Human Recombinant Protein
CAT#: TP303751
Recombinant protein of human V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 1, 20 µg
View other "VSIG4" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203751 protein sequence
Red=Cloning site Green=Tags(s) MGILLGLLLLGHLTVDTYGRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLR DSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSV SKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYF CTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGK SLPVFAIILIISLCCMVVFTMAYIMLCRKTSQQEHVYEAARAHAREANDSGETMRVAIFASGCSSDEPTS QNLGNNYSDEPCIGQEYQIIAQINGNYARLLDTVPLDYEFLATEGKSVC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 43.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_009199 |
| Locus ID | 11326 |
| UniProt ID | Q9Y279 |
| Refseq Size | 1869 |
| Cytogenetics | Xq12 |
| Refseq ORF | 1197 |
| Synonyms | CRIg; Z39IG |
| Summary | This gene encodes a v-set and immunoglobulin-domain containing protein that is structurally related to the B7 family of immune regulatory proteins. The encoded protein may be a negative regulator of T-cell responses. This protein is also a receptor for the complement component 3 fragments C3b and iC3b. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416087 | VSIG4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420270 | VSIG4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416087 | Transient overexpression lysate of V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 1 |
CNY 3080.00 |
|
| LY420270 | Transient overexpression lysate of V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 2 |
CNY 3080.00 |
|
| PH303751 | VSIG4 MS Standard C13 and N15-labeled recombinant protein (NP_009199) |
CNY 19520.00 |
|
| TP720454 | Recombinant protein of human V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 2 |
CNY 1800.00 |
