VSIG4 Rabbit Polyclonal Antibody
CAT#: TA346124
Rabbit Polyclonal Anti-VSIG4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-VSIG4 antibody: synthetic peptide directed towards the N terminal of human VSIG4. Synthetic peptide located within the following region: VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 44 kDa |
Gene Name | V-set and immunoglobulin domain containing 4 |
Database Link | |
Background | T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production. |
Synonyms | CRIg; Z39IG |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 92%; Mouse: 92%; Guinea pig: 92%; Horse: 91%; Rat: 86%; Rabbit: 82% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |