BTN2A1 (NM_078476) Human Recombinant Protein
CAT#: TP303745
Recombinant protein of human butyrophilin, subfamily 2, member A1 (BTN2A1), transcript variant 2, 20 µg
View other "BTN2A1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203745 protein sequence
Red=Cloning site Green=Tags(s) MESAAALHFSRPASLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQ FSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHL VVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGLFMVTTAVIIR DKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPCAVALPIIVVILMIPIAVCIYWINKLQKEKKILS GEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAELQFFSN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_510961 |
Locus ID | 11120 |
UniProt ID | Q7KYR7 |
Refseq Size | 3186 |
Cytogenetics | 6p22.2 |
Refseq ORF | 1002 |
Synonyms | BK14H9.1; BT2.1; BTF1; BTN2.1; DJ3E1.1 |
Summary | This gene encodes a member of the immunoglobulin superfamily. The gene is located in a cluster of butyrophilin-like genes in the juxta-telomeric region of the major histocompatibility complex on chromosome 6. A pseudogene of this gene has been identified in this cluster. The encoded protein is an integral plasma membrane protein involved in lipid, fatty-acid, and sterol metabolism. Alterations in this gene may be associated with several disease states including metabolic syndrome. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409188 | BTN2A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434252 | BTN2A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409188 | Transient overexpression lysate of butyrophilin, subfamily 2, member A1 (BTN2A1), transcript variant 2 |
CNY 3080.00 |
|
LY434252 | Transient overexpression lysate of butyrophilin, subfamily 2, member A1 (BTN2A1), transcript variant 3 |
CNY 3080.00 |
|
PH303745 | BTN2A1 MS Standard C13 and N15-labeled recombinant protein (NP_510961) |
CNY 19520.00 |