BTN2A1 (NM_078476) Human Mass Spec Standard
CAT#: PH303745
BTN2A1 MS Standard C13 and N15-labeled recombinant protein (NP_510961)
View other "BTN2A1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | BTN2A1 MS Standard C13 and N15-labeled recombinant protein (NP_510961) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203745 |
| Predicted MW | 37.9 kDa |
| Protein Sequence |
>RC203745 protein sequence
Red=Cloning site Green=Tags(s) MESAAALHFSRPASLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQ FSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHL VVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGLFMVTTAVIIR DKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPCAVALPIIVVILMIPIAVCIYWINKLQKEKKILS GEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAELQFFSN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_510961 |
| RefSeq Size | 3186 |
| RefSeq ORF | 1002 |
| Synonyms | BK14H9.1; BT2.1; BTF1; BTN2.1; DJ3E1.1 |
| Locus ID | 11120 |
| Cytogenetics | 6p22.2 |
| Summary | This gene encodes a member of the immunoglobulin superfamily. The gene is located in a cluster of butyrophilin-like genes in the juxta-telomeric region of the major histocompatibility complex on chromosome 6. A pseudogene of this gene has been identified in this cluster. The encoded protein is an integral plasma membrane protein involved in lipid, fatty-acid, and sterol metabolism. Alterations in this gene may be associated with several disease states including metabolic syndrome. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2013] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409188 | BTN2A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434252 | BTN2A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409188 | Transient overexpression lysate of butyrophilin, subfamily 2, member A1 (BTN2A1), transcript variant 2 |
CNY 3080.00 |
|
| LY434252 | Transient overexpression lysate of butyrophilin, subfamily 2, member A1 (BTN2A1), transcript variant 3 |
CNY 3080.00 |
|
| TP303745 | Recombinant protein of human butyrophilin, subfamily 2, member A1 (BTN2A1), transcript variant 2, 20 µg |
CNY 2900.00 |
