SMAGP (NM_001033873) Human Recombinant Protein
CAT＃: TP303589
Recombinant protein of human small trans-membrane and glycosylated protein (LOC57228), transcript variant 2, 20 µg
View other "SMAGP" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203589 protein sequence
Red=Cloning site Green=Tags(s) MTSLLTTPSPREELMTTPILQPTEALSPEDGASTALIAVVITVVFLTLLSVVILIFFYLYKNKGSYVTYE PTEGEPSAIVQMESDLAKGSEKEEYFI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 10.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001029045 |
| Locus ID | 57228 |
| UniProt ID | Q0VAQ4 |
| Refseq Size | 1076 |
| Cytogenetics | 12q13.13 |
| Refseq ORF | 291 |
| Synonyms | hSMAGP |
| Summary | May play a role in epithelial cell-cell contacts. May play a role in tumor invasiveness and metastasis formation.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422217 | SMAGP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422425 | SMAGP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422217 | Transient overexpression lysate of small cell adhesion glycoprotein (SMAGP), transcript variant 1 |
CNY 3080.00 |
|
| LY422425 | Transient overexpression lysate of small cell adhesion glycoprotein (SMAGP), transcript variant 2 |
CNY 3080.00 |
|
| PH303589 | SMAGP MS Standard C13 and N15-labeled recombinant protein (NP_001029045) |
CNY 19520.00 |
|
| PH318509 | SMAGP MS Standard C13 and N15-labeled recombinant protein (NP_001026798) |
CNY 19520.00 |
|
| TP318509 | Recombinant protein of Human small cell adhesion glycoprotein (SMAGP), transcript variant 1, 20 µg |
CNY 2900.00 |
