SMAGP (NM_001033873) Human Mass Spec Standard
CAT#: PH303589
SMAGP MS Standard C13 and N15-labeled recombinant protein (NP_001029045)
View other "SMAGP" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SMAGP MS Standard C13 and N15-labeled recombinant protein (NP_001029045) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203589 |
| Predicted MW | 10.7 kDa |
| Protein Sequence |
>RC203589 protein sequence
Red=Cloning site Green=Tags(s) MTSLLTTPSPREELMTTPILQPTEALSPEDGASTALIAVVITVVFLTLLSVVILIFFYLYKNKGSYVTYE PTEGEPSAIVQMESDLAKGSEKEEYFI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001029045 |
| RefSeq Size | 1076 |
| RefSeq ORF | 291 |
| Synonyms | hSMAGP |
| Locus ID | 57228 |
| Cytogenetics | 12q13.13 |
| Summary | May play a role in epithelial cell-cell contacts. May play a role in tumor invasiveness and metastasis formation.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422217 | SMAGP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422425 | SMAGP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422217 | Transient overexpression lysate of small cell adhesion glycoprotein (SMAGP), transcript variant 1 |
CNY 3080.00 |
|
| LY422425 | Transient overexpression lysate of small cell adhesion glycoprotein (SMAGP), transcript variant 2 |
CNY 3080.00 |
|
| PH318509 | SMAGP MS Standard C13 and N15-labeled recombinant protein (NP_001026798) |
CNY 19520.00 |
|
| TP303589 | Recombinant protein of human small trans-membrane and glycosylated protein (LOC57228), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP318509 | Recombinant protein of Human small cell adhesion glycoprotein (SMAGP), transcript variant 1, 20 µg |
CNY 2900.00 |
