ERp19 (TXNDC12) (NM_015913) Human Recombinant Protein
CAT#: TP303511
Recombinant protein of human thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12), 20 µg
View other "ERp19" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203511 protein sequence
Red=Cloning site Green=Tags(s) METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACK ALKPKFAESTEISELSHNFVMVNLEDEEEPKHEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYF YVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 19 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_056997 |
| Locus ID | 51060 |
| UniProt ID | O95881 |
| Refseq Size | 2412 |
| Cytogenetics | 1p32.3 |
| Refseq ORF | 516 |
| Synonyms | AG1; AGR1; ERP16; ERP18; ERP19; hAG-1; hTLP19; PDIA16; TLP19 |
| Summary | This gene encodes a member of the thioredoxin superfamily. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. This protein localizes to the endoplasmic reticulum and has a single atypical active motif. The encoded protein is mainly involved in catalyzing native disulfide bond formation and displays activity similar to protein-disulfide isomerases. This protein may play a role in defense against endoplasmic reticulum stress. Alternate splicing results in both coding and non-coding variants. [provided by RefSeq, Mar 2012] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Glutathione metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414316 | TXNDC12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414316 | Transient overexpression lysate of thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12) |
CNY 3080.00 |
|
| PH303511 | TXNDC12 MS Standard C13 and N15-labeled recombinant protein (NP_056997) |
CNY 19520.00 |
|
| TP720708 | Purified recombinant protein of Human thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12) |
CNY 1800.00 |
