ERp19 (TXNDC12) (NM_015913) Human Mass Spec Standard
CAT#: PH303511
TXNDC12 MS Standard C13 and N15-labeled recombinant protein (NP_056997)
View other "ERp19" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TXNDC12 MS Standard C13 and N15-labeled recombinant protein (NP_056997) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203511 |
| Predicted MW | 19.2 kDa |
| Protein Sequence |
>RC203511 protein sequence
Red=Cloning site Green=Tags(s) METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACK ALKPKFAESTEISELSHNFVMVNLEDEEEPKHEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYF YVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_056997 |
| RefSeq Size | 2412 |
| RefSeq ORF | 516 |
| Synonyms | AG1; AGR1; ERP16; ERP18; ERP19; hAG-1; hTLP19; PDIA16; TLP19 |
| Locus ID | 51060 |
| Cytogenetics | 1p32.3 |
| Summary | This gene encodes a member of the thioredoxin superfamily. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. This protein localizes to the endoplasmic reticulum and has a single atypical active motif. The encoded protein is mainly involved in catalyzing native disulfide bond formation and displays activity similar to protein-disulfide isomerases. This protein may play a role in defense against endoplasmic reticulum stress. Alternate splicing results in both coding and non-coding variants. [provided by RefSeq, Mar 2012] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Glutathione metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414316 | TXNDC12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414316 | Transient overexpression lysate of thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12) |
CNY 3080.00 |
|
| TP303511 | Recombinant protein of human thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12), 20 µg |
CNY 2900.00 |
|
| TP720708 | Purified recombinant protein of Human thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12) |
CNY 1800.00 |
