Neuropilin 1 (NRP1) (NM_001024628) Human Recombinant Protein
CAT＃: TP303508
Recombinant protein of human neuropilin 1 (NRP1), transcript variant 2, 20 µg
View other "Neuropilin 1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
热销推荐CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203508 protein sequence
Red=Cloning site Green=Tags(s) MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMIN FNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEI FKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDR LEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALG MESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETK KKYYVKTYKIDVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFE VYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSYINEWLQIDLG EEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTR FIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLVDECDDDQANCHSGTGDDFQLTGGTTVLATE KPTVIDSTIQSGIK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 71.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001019799 |
| Locus ID | 8829 |
| UniProt ID | O14786 |
| Refseq Size | 2478 |
| Cytogenetics | 10p11.22 |
| Refseq ORF | 1932 |
| Synonyms | BDCA4; CD304; NP1; NRP; VEGF165R |
| Summary | This gene encodes one of two neuropilins, which contain specific protein domains which allow them to participate in several different types of signaling pathways that control cell migration. Neuropilins contain a large N-terminal extracellular domain, made up of complement-binding, coagulation factor V/VIII, and meprin domains. These proteins also contains a short membrane-spanning domain and a small cytoplasmic domain. Neuropilins bind many ligands and various types of co-receptors; they affect cell survival, migration, and attraction. Some of the ligands and co-receptors bound by neuropilins are vascular endothelial growth factor (VEGF) and semaphorin family members. This protein has also been determined to act as a co-receptor for SARS-CoV-2 (which causes COVID-19) to infect host cells. [provided by RefSeq, Nov 2020] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Axon guidance |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401276 | NRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422521 | NRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422522 | NRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401276 | Transient overexpression lysate of neuropilin 1 (NRP1), transcript variant 1 |
CNY 4840.00 |
|
| LY422521 | Transient overexpression lysate of neuropilin 1 (NRP1), transcript variant 2 |
CNY 3080.00 |
|
| LY422522 | Transient overexpression lysate of neuropilin 1 (NRP1), transcript variant 3 |
CNY 3080.00 |
|
| PH302952 | NRP1 MS Standard C13 and N15-labeled recombinant protein (NP_001019800) |
CNY 19520.00 |
|
| PH303508 | NRP1 MS Standard C13 and N15-labeled recombinant protein (NP_001019799) |
CNY 19520.00 |
|
| TP302952 | Recombinant protein of human neuropilin 1 (NRP1), transcript variant 3, 20 µg |
CNY 2900.00 |
其它Neuropilin 1产品
