Neuropilin 1 (NRP1) (NM_001024629) Human Mass Spec Standard
CAT＃: PH302952
NRP1 MS Standard C13 and N15-labeled recombinant protein (NP_001019800)
View other "Neuropilin 1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
热销推荐Specifications
| Product Data | |
| Description | NRP1 MS Standard C13 and N15-labeled recombinant protein (NP_001019800) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202952 |
| Predicted MW | 68.3 kDa |
| Protein Sequence |
>RC202952 protein sequence
Red=Cloning site Green=Tags(s) MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMIN FNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEI FKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDR LEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALG MESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETK KKYYVKTYKIDVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFE VYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSYINEWLQIDLG EEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTR FIRIYPERATHGGLGLRMELLGCEVEGGTTVLATEKPTVIDSTIQSGIK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001019800 |
| RefSeq Size | 2373 |
| RefSeq ORF | 1827 |
| Synonyms | BDCA4; CD304; NP1; NRP; VEGF165R |
| Locus ID | 8829 |
| Cytogenetics | 10p11.22 |
| Summary | This gene encodes one of two neuropilins, which contain specific protein domains which allow them to participate in several different types of signaling pathways that control cell migration. Neuropilins contain a large N-terminal extracellular domain, made up of complement-binding, coagulation factor V/VIII, and meprin domains. These proteins also contains a short membrane-spanning domain and a small cytoplasmic domain. Neuropilins bind many ligands and various types of co-receptors; they affect cell survival, migration, and attraction. Some of the ligands and co-receptors bound by neuropilins are vascular endothelial growth factor (VEGF) and semaphorin family members. This protein has also been determined to act as a co-receptor for SARS-CoV-2 (which causes COVID-19) to infect host cells. [provided by RefSeq, Nov 2020] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Axon guidance |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401276 | NRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422521 | NRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422522 | NRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401276 | Transient overexpression lysate of neuropilin 1 (NRP1), transcript variant 1 |
CNY 4840.00 |
|
| LY422521 | Transient overexpression lysate of neuropilin 1 (NRP1), transcript variant 2 |
CNY 3080.00 |
|
| LY422522 | Transient overexpression lysate of neuropilin 1 (NRP1), transcript variant 3 |
CNY 3080.00 |
|
| PH303508 | NRP1 MS Standard C13 and N15-labeled recombinant protein (NP_001019799) |
CNY 19520.00 |
|
| TP302952 | Recombinant protein of human neuropilin 1 (NRP1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP303508 | Recombinant protein of human neuropilin 1 (NRP1), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Neuropilin 1产品
