ZFYVE21 (NM_024071) Human Recombinant Protein
CAT#: TP303337L
Recombinant protein of human zinc finger, FYVE domain containing 21 (ZFYVE21), 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203337 protein sequence
Red=Cloning site Green=Tags(s) MSSEVSARRDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQWVPDKECRRCMQCDAKFDFLTRKHHCRRCG KCFCDRCCSQKVPLRRMCFVDPVRQCAECALVSLKEAEFYDKQLKVLLSGATFLVTFGNSEKPETMTCRL SNNQRYLFLDGDSHYEIEIVHISTVQILTEGFPPGGGNARATGMFLQYTVPGTEGVTQLKLTVVEDVTVG RRQAVAWLVAMHKAAKLLYESRDQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 26.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_076976 |
| Locus ID | 79038 |
| UniProt ID | Q9BQ24 |
| Refseq Size | 1470 |
| Cytogenetics | 14q32.33 |
| Refseq ORF | 702 |
| Synonyms | HCVP7TP1; ZF21 |
| Summary | Plays a role in cell adhesion, and thereby in cell motility which requires repeated formation and disassembly of focal adhesions. Regulates microtubule-induced PTK2/FAK1 dephosphorylation, an event important for focal adhesion disassembly, as well as integrin beta-1/ITGB1 cell surface expression.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它ZFYVE21产品
