APIP (NM_015957) Human Recombinant Protein

CAT#: TP303297L

Recombinant protein of human APAF1 interacting protein (APIP), 1 mg

Size: 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 36000.00


货期*
4周

规格
    • 1 mg

Product images

推荐一起购买 (2)
Mouse Monoclonal APIP Antibody (19F461)
    • 100 ug

CNY 5381.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC203297 protein sequence
Red=Cloning site Green=Tags(s)

MSGCDAREGDCCSRRCGAQDKERPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAPSGVQKERIQP
EDMFVCDINEKDISGPSPSKKLKKSQCTPLFMNAYTMRGAGAVIHTHSKAAVMATLLFPGREFKITHQEM
IKGIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAVNEYPDSCAVLVRRHGVYVWGETWEKAKTM
CECYDYLFDIAVSMKKVGLDPSQLPVGENGIV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_057041
Locus ID 51074
UniProt ID Q96GX9
Refseq Size 1285
Cytogenetics 11p13
Refseq ORF 726
Synonyms APIP2; CGI-29; CGI29; hAPIP; MMRP19
Summary APIP is an APAF1 (MIM 602233)-interacting protein that acts as a negative regulator of ischemic/hypoxic injury (Cho et al., 2004 [PubMed 15262985]).[supplied by OMIM, Dec 2008]
Protein Pathways Cysteine and methionine metabolism, Metabolic pathways
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...