APIP (NM_015957) Human Recombinant Protein
CAT#: TP303297
Recombinant protein of human APAF1 interacting protein (APIP), 20 µg
View other "APIP" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203297 protein sequence
Red=Cloning site Green=Tags(s) MSGCDAREGDCCSRRCGAQDKERPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAPSGVQKERIQP EDMFVCDINEKDISGPSPSKKLKKSQCTPLFMNAYTMRGAGAVIHTHSKAAVMATLLFPGREFKITHQEM IKGIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAVNEYPDSCAVLVRRHGVYVWGETWEKAKTM CECYDYLFDIAVSMKKVGLDPSQLPVGENGIV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057041 |
Locus ID | 51074 |
UniProt ID | Q96GX9 |
Refseq Size | 1285 |
Cytogenetics | 11p13 |
Refseq ORF | 726 |
Synonyms | APIP2; CGI-29; CGI29; hAPIP; MMRP19 |
Summary | APIP is an APAF1 (MIM 602233)-interacting protein that acts as a negative regulator of ischemic/hypoxic injury (Cho et al., 2004 [PubMed 15262985]).[supplied by OMIM, Dec 2008] |
Protein Pathways | Cysteine and methionine metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414309 | APIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414309 | Transient overexpression lysate of APAF1 interacting protein (APIP) |
CNY 3080.00 |
|
PH303297 | APIP MS Standard C13 and N15-labeled recombinant protein (NP_057041) |
CNY 19520.00 |