DAP13 (NDUFA12) (NM_018838) Human Recombinant Protein
CAT#: TP303265
Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 (NDUFA12), 20 µg
View other "DAP13" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203265 protein sequence
Red=Cloning site Green=Tags(s) MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNG KNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLAARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPP STPYK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 16.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_061326 |
| Locus ID | 55967 |
| UniProt ID | Q9UI09 |
| Refseq Size | 592 |
| Cytogenetics | 12q22 |
| Refseq ORF | 435 |
| Synonyms | B17.2; DAP13; MC1DN23 |
| Summary | This gene encodes a protein which is part of mitochondrial complex 1, part of the oxidative phosphorylation system in mitochondria. Complex 1 transfers electrons to ubiquinone from NADH which establishes a proton gradient for the generation of ATP. Mutations in this gene are associated with Leigh syndrome due to mitochondrial complex 1 deficiency. Pseudogenes of this gene are located on chromosomes 5 and 13. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412878 | NDUFA12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412878 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 (NDUFA12) |
CNY 3080.00 |
|
| PH303265 | NDUFA12 MS Standard C13 and N15-labeled recombinant protein (NP_061326) |
CNY 19520.00 |
