RNF34 (NM_025126) Human Recombinant Protein
CAT#: TP303191
Recombinant protein of human ring finger protein 34 (RNF34), transcript variant 2, 20 µg
View other "RNF34" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203191 protein sequence
Red=Cloning site Green=Tags(s) MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNIVCKACGLSFS VFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYLILRNIPIDTCREK EDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSSFQGELMDGDQTSRSGVPA QVQSEITSANTEDDDDDDDEDDDDEEENAEDRNPGLSKERVRASLSDLSSLDDVEGMSVRQLKEILARNF VNYSGCCEKWELVEKVNRLYKENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCG KRMSECPICRQYVVRAVHVFKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 41.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_079402 |
| Locus ID | 80196 |
| UniProt ID | Q969K3 |
| Refseq Size | 2055 |
| Cytogenetics | 12q24.31 |
| Refseq ORF | 1116 |
| Synonyms | CARP-1; CARP1; hRFI; RFI; RIF; RIFF |
| Summary | The protein encoded by this gene contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alpha induced apoptosis, suggesting an anti-apoptotic function of this protein. This protein can be cleaved by caspase-3 during the induction of apoptosis. This protein also targets p53 and phospho-p53 for degradation. Alternatively splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403050 | RNF34 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC403664 | RNF34 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403050 | Transient overexpression lysate of ring finger protein 34 (RNF34), transcript variant 2 |
CNY 3080.00 |
|
| LY403664 | Transient overexpression lysate of ring finger protein 34 (RNF34), transcript variant 1 |
CNY 3080.00 |
|
| PH303191 | RNF34 MS Standard C13 and N15-labeled recombinant protein (NP_079402) |
CNY 19520.00 |
