RNF34 (NM_025126) Human Mass Spec Standard
CAT#: PH303191
RNF34 MS Standard C13 and N15-labeled recombinant protein (NP_079402)
View other "RNF34" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RNF34 MS Standard C13 and N15-labeled recombinant protein (NP_079402) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203191 |
| Predicted MW | 41.6 kDa |
| Protein Sequence |
>RC203191 protein sequence
Red=Cloning site Green=Tags(s) MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNIVCKACGLSFS VFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYLILRNIPIDTCREK EDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSSFQGELMDGDQTSRSGVPA QVQSEITSANTEDDDDDDDEDDDDEEENAEDRNPGLSKERVRASLSDLSSLDDVEGMSVRQLKEILARNF VNYSGCCEKWELVEKVNRLYKENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCG KRMSECPICRQYVVRAVHVFKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_079402 |
| RefSeq Size | 2055 |
| RefSeq ORF | 1116 |
| Synonyms | CARP-1; CARP1; hRFI; RFI; RIF; RIFF |
| Locus ID | 80196 |
| Cytogenetics | 12q24.31 |
| Summary | The protein encoded by this gene contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alpha induced apoptosis, suggesting an anti-apoptotic function of this protein. This protein can be cleaved by caspase-3 during the induction of apoptosis. This protein also targets p53 and phospho-p53 for degradation. Alternatively splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403050 | RNF34 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC403664 | RNF34 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403050 | Transient overexpression lysate of ring finger protein 34 (RNF34), transcript variant 2 |
CNY 3080.00 |
|
| LY403664 | Transient overexpression lysate of ring finger protein 34 (RNF34), transcript variant 1 |
CNY 3080.00 |
|
| TP303191 | Recombinant protein of human ring finger protein 34 (RNF34), transcript variant 2, 20 µg |
CNY 2900.00 |
