IP10 (CXCL10) (NM_001565) Human Recombinant Protein
CAT#: TP303141
Recombinant protein of human chemokine (C-X-C motif) ligand 10 (CXCL10), 20 µg
View other "IP10" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203141 protein sequence
Red=Cloning site Green=Tags(s) MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKG EKRCLNPESKAIKNLLKAVSKERSKRSP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 8.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001556 |
| Locus ID | 3627 |
| UniProt ID | P02778 |
| Refseq Size | 1227 |
| Cytogenetics | 4q21.1 |
| Refseq ORF | 294 |
| Synonyms | C7; crg-2; gIP-10; IFI10; INP10; IP-10; mob-1; SCYB10 |
| Summary | This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. This gene may also be a key regulator of the 'cytokine storm' immune response to SARS-CoV-2 infection. [provided by RefSeq, Sep 2020] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419857 | CXCL10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419857 | Transient overexpression lysate of chemokine (C-X-C motif) ligand 10 (CXCL10) |
CNY 3080.00 |
|
| PH303141 | CXCL10 MS Standard C13 and N15-labeled recombinant protein (NP_001556) |
CNY 19520.00 |
|
| TP723726 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 10 (CXCL10 / IP10) |
CNY 3560.00 |
