C1orf57 (NTPCR) (NM_032324) Human Recombinant Protein
CAT#: TP303017
Recombinant protein of human chromosome 1 open reading frame 57 (C1orf57), 20 µg
View other "C1orf57" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203017 protein sequence
Red=Cloning site Green=Tags(s) MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPP PGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTII LGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115700 |
Locus ID | 84284 |
UniProt ID | Q9BSD7 |
Refseq Size | 926 |
Cytogenetics | 1q42.2 |
Refseq ORF | 570 |
Synonyms | C1orf57; HCR-NTPase; THEP1 |
Summary | The protein encoded by this gene is a non-specific nucleoside triphosphatase that is slow-acting in vitro. This gene is overexpressed in many tumor tissues, and while it is not essential for the cell, overexpression is cytotoxic. However, the cytotoxicity is not related to its triphosphatase activity. [provided by RefSeq, Jul 2016] |
Protein Families | Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410200 | NTPCR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410200 | Transient overexpression lysate of chromosome 1 open reading frame 57 (C1orf57) |
CNY 3080.00 |
|
PH303017 | C1orf57 MS Standard C13 and N15-labeled recombinant protein (NP_115700) |
CNY 19520.00 |
其它C1orf57产品